REShow: Gabe Lacques - Hour 3 (7-8-2022)

The liberty of and from Delta technologies is here. It's time to take productivity to another level. In the summer strong upgrading your growing business to the latest tech.

This new season begins with up to 48% off top performance laptops like vostro taking performance to the next level with 12 GEN Intel core processors will also save big on monitors, docs, mice, and more must-have accessories plus get free shipping on everything. It's the perfect time to get ahead with powerful tech designed to stay motivated throughout the year and encourage collaboration and innovation among your team now at special prices for a limited time only summer might be gone but it's just the beginning. What's next for you upgrade today by calling 877 asphodel that's 877 asked Dell to save up to 48% on our latest technology is that rich eyes and show you when wanting your minimalism show live from the ranch show studio in Los Angeles want to hear that absolutely don't want to shout out sports) in the four rich Friday beautiful Friday, at least on board, please go zero everybody is finding themselves in a six summary weekend coming up.

Last night I tried to follow the draft and I commend the NHL for trying to make this into a spectacle like the NFL has mastered the NFL draft being a credible event like hundreds of thousands of people show up. They pack entire cities as a whole run of the event I remember. By the way, as a youngster when the draft is always held in New York. It was at the Paramount theater at Madison Square Garden wasn't even in the main. No part of Madison Square Garden were the Nixon Rangers play where you know. 19,000 people can sit. It was in the Paramount theater of Madison Square Garden which, like a smallish theater within the confines of the building. I remember as a high school. I guess I was a junior or senior going to the 1996 tractor just as Jeff and the Jets at the number one pick in the draft Shawn Johnson so I went. We sat there for hours and is great and then as the draft grew in status and I got into this business. I went to the radio city music Hall draft. Robbie said that's a massive place and I've seen the expansion of the draft when it went to Philadelphia a few years back and just hundreds of thousands of people packing the you know the roadway leading up to the steps of the art museum, rocky steps, you know, and you saw what happened when it was in Vegas this year. The amount of people with covert right I mean it's it's massive what's become of the NFL draft the NBA draft is a big spectacle as well.

It's great. It's fine. Baseball is now started televising their draft just a few years back I mean it wasn't as if every year they televise the draft wasn't a big deal to them in hockey is always trying to do a nice job televising it have the top players be there they had in Montréal. He got fans.

It's cool, right, tuned in yesterday to watch because I love sports and I am a hockey fan, so I wanted to watch.

The problem is you cannot get really invested in the NHL draft even as a hockey fan unless your team is taken first, second, third, whatever it might be even then it's hard to get invested for two reasons. One, you don't know these players we aren't watching these guys.

Jaroslav Koski going number one overall to the Montréal Canadiens in Montréal is a cool story for the 2022 upper deck draft at the Bell center to cool story and I'm sure he's a great player playing in Finland being a Slovakian. Did anybody watch TPS illegal Finland's top professional league play a lot of TPS fans.

There a lot of you guys watch TPS on not take the light from Europe. No you not right. The number two guy don't know who he is, either. I have no idea who these guys are and I've never seen them play that's the issue Simon or Simone Namic but by the devil number to another Slovakian Logan coolies in American I've never seen him play. Why because they're playing in overseas leagues for one or the plane for the US developmental league, which got out where my watching those games. I'm not. I don't watch junior hockey coming out of Canada, like the Oshawa generals. I'm not watching that the Sault Ste. Marie whoever's right Mustangs.

Whatever it is Peter Perrault I don't know. I don't know these guys.

We can look at statistics is a well. I put up big numbers but I guess coming from your eight don't put up big numbers and be ones coming out of the OH on these Canadian leagues everybody puts a big numbers in those leagues.

So the whole thing that I'm telling you, and looking at is the fact that I don't feel invested in the NHL draft kind of like the baseball draft because for one we just don't know these guys we've never seen them play, etc. highlight reels. I can make a highlight reel of anybody and make them look great right because it's picking and choosing a very minuscule amount of times in film compared to the entire body of work of watching them, 10, 20, 30 times a year and seeing them play over the course of noxious again but the season were looking at a two minute highlight reel going looks great. Maybe looks terrible. Your film right we don't know. You can manipulate highlight reels left and right high school prospects to all the time to try to get college scholarships or coaches will you know pick the four great plays they've made you feel they may have had 20 terrible missed tackles high throughout the course of the game. That's the first problem the second problem is just because you draft a guy when he can actually see them play in the NHL.

Even number one overall pics now don't go straight into the NHL. The guy last year and went number one overall I believe played at Michigan this past year.

Now you to be in NHL a year after being drafted number one mission had like five guys were high first-round picks on the roster this year so maybe this Jaroslav Koski is going to be playing for the Canadians this year may be returned sufficiently for one more year of quote seasoning right this guy Logan Cooley. He went third overall to Arizona I believe is going to play college hockey for a year, but I'm a New York Ranger fan. They drafted Igor's hysteric and in like 2014 income to the states like 2019 2020. They drafted key Andre Miller. He played Wisconsin for a couple years before he came so just because you may get excited because they had a high draft pick in draft the guy that an analyst tells you looks great and is a big part of your team's future.

You're not even see them play the NHL level.

Most likely for a couple years and that so similar to the baseball traffic the hockey draft mirrors to be the baseball draft which is a bunch of college players or high school seniors and there's too many guys to choose from and were not watching high school baseball.

Very few of us will sit there, watch the College World Series as fun as it is very few people actually sit there watching called World Series so you don't know these guys and then once you draft the guy even number one overall Edison high school in like round rock, Texas or Harvard Westlake high school in California. It's like the LA region right art Harvard Westlake yeah it's up in the Valley. Yeah our house is a good look for guys. Major league baseball writing right now right teammates at Harvard Westlake at the same time as I want Max freed. I think of the Braves, Lucas cheerleader, think of the White Sox.

The guy pitching for the Cardinals, and I forgot who the other guys. I think three or four guys off that seem like rotation or pitching several high draft picks role playing in the major leagues.

Right now the better of one state that units Phil built Bickford Philbrick from the Dodgers Dodgers and the Cardinals. I forgot just came back from the making of these lessons. Kennedy or something ski back from an injury. I think they'll plaything the same time at Harvard Westlake again. The big benefit of one state.

It's like when I things like Joey Gallo, Bryce Harper and I forgot who the other player was role-playing God same time, for in Vegas but again you know you draft a guide number one overall in baseball. He's in the major leagues. Three years later that's a quick rise right is an eight-year-old kid at a high school you draft them goes through rookie league if he's a college guy usually starts in single-A. Then if he does well. He gets moved up AA AAA if you're lucky in three years a guys gonna be that you never knew he was on track night because you watch high school baseball even college baseball and even after being excited that they got a guy that the analyst tell you is great.

You don't see them for three or four years. Does that sound very familiar to what I was just talk about the hockey draft the exact same concept so hard to get excited when you just don't know the prospects the NBA draft of the NFL draft is a pattern right you do your mock draft if you're a real fan. You do a mock draft and then you follow along and then based on who's getting picked where you start to shift your draft boards of whose remaining who went higher than you expected, whose kind of dropping the fun part and be seeing these guys because most of us that love sports will sit there and watch college football on a Saturday so we've learned who the players are that we should look for to write in any of the combine process.

You have seen your bowl, you have the personal workouts at their respective schools that you hear so much about you hear about so and so he ran a 43 4:40 for the combine boom draft stock is increased in the NBA. You've watched them play.

Most likely a one and done year and a top program that's on TV that usually makes the NCAA tournament.

So you get the watch on the national stage of March madness and sure you got like the euro players that you may not know right, but they're kinda sprinkled in their the majority. The bulk of the guys you do know you know the tray Young's coming out to DeAndre Athans, Marvin Bagley's you understand these guy you know look at dungeon tricks of what you read from the scouting reports how you exploded this many points, plaintiff wasn't by a real real Madrid or something or Barcelona in the unity, the euro league, but that's all you here if you don't really know the European guys then will make up the bulk of the actual draft so as I commend the NHL and major league baseball for trying to make the draft big because they see the success of the NBA, and especially the NFL, they will never get to those heights because we don't know these guys and they don't come straight into the league the way that in the NFL and I go straight into your protein is no minor-league and in the NBA. If your high traffic has to go play in the G league, then obviously he stinks.

It should have been drafted that high right that's the problem when I draft it ends up in the G league. It's because he's failed in the NBA for two or three years. 19 thanks okay this is the last chance to maybe be able to salvage and let them go play Julie ball and hopefully a light bulb goes off in his head and he changes it's a problem but you can't change. There's no way to change it is even if you try to televise finish league games work AHL games. Whatever it might be knowing a lot right when baseball had a lockout, I too did watch some Korean baseball. I watch Japanese bass player never know Jenny I'm half my mother's from Japan.

I know Japanese baseballs all watch. I appreciate understand and I know the top players, but I could watch Korean baseball and all the guys as much of the baseball fan you might be just as it and I can sit there and watch like I was a little desperate because I love major league baseball and watch a spring training game, but they were locked out.

We didn't have an opportunity to watch this stuff so I did watch Korean baseball and was gladly watching Japanese baseball but it's hard to get invested because again I don't know these players a handful of guys that you may have heard about it, especially in Japan you have. I think I think there's a limit of two or three Western players that you can have on your team that you hear about some these guys remember the name from when they were in the major leagues.

So member half decent players.

Others were not as hard if you don't know, guys. It's very hard to be invested. That's really a major problem there it is. And that's what happened with the NHL draft yesterday. I just could not I can follow it. Cannot follow it and finally chose something or with NHL draft like NBA. You see a lot a lot of trades write a lot of draft picks are picked in the guys treated.

He never actually suits up for the team that drafted him. There were a lot of trades tell draft Riley thinking just seen that teams were not valuing draft picks. They were getting veteran players for draft picks.

I think it was Arizona treated pretty high pick. I think the Navy league traded module traded the defenseman and 1/4 round pick. The bench was numbered only teen parents. Some goalies traded the it's really strange ions and it's it look like the NBA draft. In that regard were team to try to get outs of drafting the first round, and I don't know the NBA. There's a reason because the guy select in the first round is a guaranteed contract.

Once you get past the first round in a second round picks are not guaranteed contract you draft I stashed in Europe for years.

It doesn't matter, they may never come over right we want to pay for some pics you have to pay so some teams that are you know in in weaker drafts, especially will treat their draft pick. Like it's monkeypox they will run from it. They don't want it because they don't want to deal with having to put a guy in a roster and guarantee him a contract because of where he was drafted hot ghetto things the same way you hold onto these rights but thanks for traded like trainees think like it's a candy you know, no big deal yeah take the 13th pick all the drives my like goodness the 13th like holding onto.

That's a big pickup.

Now take this 13th pick give us is Alexander Romanoff. Also, by the way hockey draft yesterday are GCB, the two Russian talents like two Russians were like really highly regarded this defenseman in the soffits of guy. And then one went 20th one went like 26th overall but apparently they were projected to go much much higher. And what the story was it's the prudent factor. Yes, they can't guarantee that they can get these guys out our rush are they gonna want to come play in Russia craziest thing like really the crazy story. This guy went 26th. Overall I think it was were 20 and ready go my guy that which I think 24th then you let your rough draft the 24th. Overall, after the Russian defenseman Yvonne mure rush niche and go went 20th. The guy went 24th was apparently like a legit top 10 talent horse. Are these the Russian juncos, a left-winger, but this guy was these guys went much lower than they should of gone because the fact that people are afraid you can't get them out a rush right now with what's going on and hello and will put in let him go. That's the thing right or as you get forced into playing the cage shell because hey let's beef up barley screen of the forget the last forget American or NHL.

Let's make the cage shell better. You know which is the second best league in the league in the world anyway for hockey.

Let's make it where you are going to play here and represent your country by playing in your countries league and its relations improve that one day go play in the NHL right. They would have to sit out a year or two anyway. Usually they do in Russian. A key play in the cage of the contract ends, but I'll tell you what light you consider that our deaths get sent to the Glock what that one guy did is that crazy story of this guy, this Flyers goaltender. Some descents are one of the top goaltenders in the world not playing in the NHL. Using a six round pick in 2015 and he's really developed into a top goalie and he was in Russian. There's like a document hitting a documentary being filled on this guy in the Flyers were expecting him to come to This year and truly find to be the starting goalie Giscard Hartz not been any good since being a top prospect is lived up to it so they had the expectation is guy for the door of her something was going to show up in my fight for that number one job well.

He's leaving his his rank in St. Petersburg and he's met my like military police starts having like heart palpitations because he's like oh my gosh goes to a hospital.

No one knows and happens the next thing you know is pictures of them at some sort like Russian naval base in Siberia and the talk now is like they are going to conscript and for a year because he didn't do as one your military service you see that's the prudent factor right and apparently the Flyers haven't had contact with his agent has enough contact with them and no one knows it's going on except that there's a picture of him at some Russian naval base in Siberia and the rest of talk now as other teams with Russian stars that have actually gone back this off-season like your real purpose purpose. I think his name is guy from the Minnesota wild in the star player and also visits Sarawak in ileus rock in the goalie for the Islanders.

They also play for the CSKA Moscow team which is affiliated with the military and their in Russia and the Wiley claim to not worry that they're going to be held back and not allowed back here.

There is some concern. This Carrillo carpets offer something from the Minnesota wild. They there was this rumor going out my my pond is wild rumor that he was under arrest because he had a falsified military ID or something at some crazy talk. All he seems now scrambling real quick systemic and I is and I know it was you stone prudent and that's it.

Put them on a popular move food and loves to play hockey and he loves the score and told him to go to the exactly that Sir Hawkins finish root purchase Derek into the Rangers are just one of as a trophy decided that he wasn't going back to the off-season he stayed in New York to get people where is a very smart move. You it is insane what's going on. He saw yesterday play out in the hockey drama going on with Britney Greiner to yeah no absolutely unbelievable where talks of baseball next day. Blacks you will join us as one of talk a little lost her pulse. Of course the notes on its next enforcement info Rich Eisen on a Friday right here in the rich.

I does your antiperspirant keep you dry all day. Dove men plus gear dry spray goes on instantly drive for a cleaner fuel and offers 48 hours sweat and order protection repeat that 48 hours of sweat. In order protection. Use it and don't even think about it. Also dove men dry spray contains doves unique one quarter moisturizing cream. It helps protect your skin trite dove men plus care dry spray goes on dry cleaning fee all day. There were three Rich Eisen showed enforcement info Rich on this Friday. Major league baseball halfway point of the season. The All-Star game coming up shortly soon as you like baseball star game. I do want of better ones for me better than the NBA better than the NHL way better than Wrobel.

In fact, I think the best for major sports lot to get into bring on gay Blacks covers MLB for USA Today sports and okay I want to start Outlook acting senior talk show a Otani every single day, but the guy just as strong. What four straight starts where he is not allowed an earned run.

He's on pace of the usual 35 or so homeruns and yet you know people say he won the MVP last year's team just not that good this year. Maybe he's not been as good hitting wises your please been a better picture this year, Gabe.

I mean if he continues us and ends up with 200 strikeouts 12 wins in its 35 homeruns and gets 100 RBIs you still give me MVP Darren Judge really good question and one that gave a little more little more validity with every you know, six or 7 Soda Rd.

Mike ruled MVP voting is there.

There are no real you never know what direction given you can locate and where will take you and I I generally don't prefer repute coming from non-playoff teams from Last Pl., James or whatever the case may be, but at the same time you do have to you can't get out not say that that can't happen sometime to show it Otani comes around on 2003, A-Rod ordered 52 homeruns for lastly you just never know what a given year will bring in stock. I think at this point Aaron judges Dooley and BP, especially with the numbers putting up in the offense of environment that we have this year, but the by all means we can't get jaded by what Otani did last year. But what he's doing this year.

It seems almost strangely underrated or underappreciated. So definitely pumping to keep an eye on and appreciate that you can build on the baseball fanatic, it's me.

I'm a Yankee fan to end when it comes Darren Judge in the contract negotiations that are either secretly taking place now will will begin once the off-season begins. You have other guys that you can look and say this guy makes X judge will make more than that, but there similar types of players right. He could feel the centerfield is obscure very dangerous back Otani hits free agency or year later, and he'll be a year younger than what judges when he hits free agency this off-season and there's no comp. So when it comes financially down to a Gabe and you're not an account.

I don't think the reality is, what kind of money our idea think that a showing Otani's going to get per year because again you can't put them up against another guy and say well he makes X he should make why you know very so many conversations of that nature happening in so many problems right now because you're also trying to project players and trying to figure out will you pitch at the bigger question will be pitch at this level for an extended period of time that you know clearly, clearly, what separates them from your garden-variety slugger. Even if he does I made it up if you get another 46 homeruns mixture of 40 next year and the market get Ola at less than 30 years old, or just about 30 years old that will commit them plenty of money and certainly the kind of money that the judge is seeking somewhere on $200 a year, $30 million and average annual value. That's probably fair because yet you getting getting better as a picture you already have one. Tommy John surgery so you do worry about a second on the other hand, you got it out of the way, quote unquote so that I had a good working ability and it and then you throw out the fact that there okay what what is Otani work as their drawing card you international interest sponsorship and all that, the docket really unanswerable question because the you would think you would be a bigger star and and that the coming Anaheim in the unit in your area, but not Los Angeles.

Either you wonder how much more marketable 20 might be in a New York or LA proper or for no more unwanted franchise.

The electric code or the Red Sox or a team that can make the playoffs normal a lot of unknowns with that as well. But the yeah he remained upright and healthy and does not take a step back. You want – you know, are we looking at a $40 million your player you look back at his age is that might make a lot more sense of maybe slightly shorter term deal or massive average annual value that that maybe wouldn't you know what best suits important future.

So it it's coming quickly and the time talk about it is pretty much here so it's a really great point that you just assume here's this you know with the DH being universal. Now he can always DH right and if you worry that the innings that he's gonna pitch a starter. His stuff is closer stuff as well.

Right. Think about it. He throws 101 has incredible secondary pitches as well. You worry that innings maybe later this grade becomes closer, so there still options of how you can say I can pay 40 million and I don't think at the end of the contract. I'm getting ripped ripped off because the fact there's other avenues of what he can do on the field where he can continue to justify more so than a one-dimensional player and I like as a judge is truly one-dimensional, but he's a slugger right in place.

Good outfield, but that's it. If he's hurt. He can't just moonlight is something else way that showing Otani can so I think that's me is a difference where maybe you can justify a longer-term contract because there's the option of him as a closer or just quickly DH and is well while getting healthy from a Tommy John which we saw in the past gave so crazy really about oversight or we will remain over the future of pitching is going either you know your I think you're going to see more guys maybe in the way back on all the firemen but I think you can see a lot more valuing guys who can pitch three high levered meaning of parenting twice a week. You don't like creating twice a week. Click downgrade your argument here to take down the heart of the order wants your cover in the fifth, seventh, eighth inning that would be a phenomenal role for him question is if you needed so much planning and chemical a rigorous schedule. You basically pitching is not one every five big guy once every 70 notice you tobeWednesdayThursdaySundayMondayyoucancanemailalittleloosergoingforwardisregimentedandallthatandlookphysically.It'snotsopredictableaboutyouifyoulettheangelreallystumbledonareallygoodplanwerelookingatatrightnowgoingon.Hereyoureallygreathelpintheoppositearmholdinguptheylivedatleastalittleonsomethinganditdiditagainifyouworkforaboutokaygetontheothersideof30.Goingforward,SabbathdayblackskywasbasedoffUSATodaysportsyearonthericheyesandsodancewhat'sbeeninforRachelandappraiseWorldSerieschampionsgotofftoaslowstart,theyturnthingsaround.Oneofthebigreasons.AsarookienamedSpencerStrider.Imean,whatitwhoisthisguyremarkable.YouknowthenextfactorthatnobodyreallyconsideredandthatIwouldthrowingdirtontheirchancesthisyear,perse,butreallydidn'tthinkthattherewasahangoveryearinprogressandhesteppedonthethingyoustartedoutstartedoutinthebullpenstartedoutthekindgettingspoonfedinningandwhatnotbutnowit'sjustthatyousuchabigboon.Imean,whenyoucombinetheemergenceofKyleWrightwithSpencerStriker.ThensuddenlyyouknowtheblowsofCharlieMortonthatwaspercentagewhichisnotanAll-StarlevelandIndianAndersonthinkingtosuddenly20,thestomachandherewearetalkingaboutaguyjustbeforeBrownpickedacoupleyearsagoIwentonveryquicklybutthatbecameratelegitofthestuffisverylegityetagainthatthebacknineandalwaysinterestingtoobserverealcanyoukeepitup.Canhehandleclinicalbeliefinanythingthatyouknowthatisalwaystrickyforyouknowforayoungpitchergoingthrough96.Endinglastyear.Totaldidnottouchatallin2020.Afterhisgrant.Harrietextendingsodoyoualittlemoreinthesecondpropertyjust,likethethrowthatcautiontothewindandinhopebookhopeyoucankeepitupahugequestionforthemandthatisgoingtobeaphenomenalrateseparatesbackonacouplereallygreatgameswiththewithreally,reallybigexpectationthatIwantedyoutogetagreatNLDshootoutwiththreecoreteamyoulikeitalwaysacouplecamethedisappointedgearbutbraidedmetalductworkbetterwiththecostofadmissiongoingdownthestretch.Yes,everyveteranaskedJamesmesogettinghealthyisthepitchingstaffwithscissorbacktothegroundisnowrehabbingandshouldbebacksometimesoongaverealquick.Yankeesaresixmorewinsthananybodyelse.Theyscorethemostruns.TheygiveuptheleastamountofrunstobeoneoftheweaknessesissometimesbeenAaronBrunetmanagerbeingalittletoomuchbythebook.SamethingthisyearhaveyounoticedmaybeashiftinhimasoneofthereasonswhytheYankeeshavebeenthisgood.IthinkIthinkthatthedominantinterestinsuchthattherethey'reabletokickanyofthatandalotofalotofrigiditycomesfromfrontofficeaminutethinking.IthinkthereasonhewasnearingandGirardiwasnolongerLarryGerardimightoccasionallygowiththegutfeelalittlebitandtookhimtowithinagameabout27WorldSeries.YouknowtheYankeeswereseekingevenmorebythebookmoreanalyticallydrivendecisionsowhatIgottasayIwasn'tontheirtrainatthestartoftheyear.Ithoughttheywouldgetoneofthelastwildcardyoucanbethreeorfourinthatelite.Thestepstakenbyparticularpitching.YoutalkaboutJordanMontgomeryJamisonTyroneDr.Cortezyouandwhattheyneeded,authenticallydeepanditwasperfect.Thecatchingduo–ShilpadeepensO'Connorleftthemovinglaborovertosecondbase.AlthoughworkedbrilliantlyandI'mI'mstunnedathowwellit'sworkedoutsocreditcredittothem.Noquestion,GabelackscoveringbaseballforUSATodaysportscapesappreciateahabitontheshell.Haveagreatweekend'sgreatstuffthatIlovetalkingbaseline.IgottasayIlove.I'm43yearsoldtobe44inSeptember'srightsare.GetthepresencereadyandIknewthatgenerationwerebaseballstillnumberone.Iknowthatfortheyoungerguysandgalsfromme,baseballisn'tnumberone.It'stoolong.It'ssoboringallmygoodness,whatspeedupthegate.HonestlyCiminoplumbingisseatedusdowntheabsolutehalfhourtomakethefoodinyourlittlecheaperbenoforgetthelengthagainstthepricethefoodandappeardownmakealittlecheapertositthereallday.MyidealofhavingmyideaofheavenissittinginaballparkwithahotdogandabeerthatIhadtotellyou,Dr.dogsandoverratedARIARIitwasIcameouttoLAallbeefdodgerdogallgoshthat'sthat'sheavennowNorfleetwasa20bucksorsomesomeridiculousandIknowthat'sit'soutrageousnow,butIwasoutthereIwenttododgerStadiumuntothebiggatedBenadrylearlylikethreeorfourtimeslastlikesixyearsorfiveyearsandIwenttoDr.Stadiumupintothebigday.Clearly,Dr.statedMs.greatIloveit.Iknowthatpeoplewanttodosomerenovationsunitbutit'sgreat.Ilovethewaythisyoudon'thaveabadseatinthehouse.Ilovegoinguptotherooftakenlookeddown,awesomeplacemoresothebigdaywhichtomeismorecookie-cutter.YouknowfoodwhysellingdodgerStadium.Dr.dogthehelmetednachossickmanIworkalldayallweektoaffordtojustthereintheyeahexactlyincrediblyexpensivedayforCodyBelanger'ssalarycandisappointyou.OnceDFADebbieMuncy.Ieliciting53wins.ItisalwaysquestionsFreddieFreeman'sgoodyouknow.ButIagree,whatisthedeal.Lukey'sMookieofcourse,butCorycalendarsintool1111homeruns.Whatisnextmonthsheis164ahomerunshe'sbecomeJoeyGallolightwithlessstrikeouts,butIdon'tIdon'tunderstandBaldrystillyoungis26yearsoldrighthadthatgreatrookieyear.ThirdyearhewinsMVPandhehasdroppedoffthefaceoftheearthsince2019whenCodyBelanger,rightfullyso,wontheMVPwitha305average47homers115RBIs95walkshundredeightstrikeoutsisa1.035.Hehadawarofninenetyear20223912homerunsokayshortenseason2021,165,10homerunsthisyearto1111homerunsand76games92strikeoutsin280at-bats.Thisisaguywhoin2019forgothundredeighttimesin558at-batslastyear.Forgot94timesin315at-bats.Thisyear'sraceforgot92timesin280at-bats.Iwillpolitelysay,okay,maybethisguywasliterallyuptoittoyourmind.He'ssolidandcenterfieldhim.Hecatcheseverythingyetbutareyoupayingyouthingsbasicallypayingacenterfielderhit200giveyouJoeyGallowaypayingaBelanger,Ididn'tgetabigcontract.Hedidsodoyouwanttomaybefuturestudiescruising.Ijustwanttoknowyoulookathimnow.Heseesnottriesatcertainlynottryinghardenough…Ashleymaking16.10mygoodness,16.1million.Ohmygoodness,that'sgottabethebiggestquestionthatcityrightnowitcomestobaselikewhat'shappenedlikewhathashappenedlazyjustlookafterthisyear.He'sarbitrationeligiblenextyearandthen2024isafreeagentandatthispace.IfhedoesnotgobacktobeingtheCodyBelangerforthefirstthreeyearsofhiscareerandtellyourightnow.Hewillnotbeadoctorin2020.I'mnotyogahappyabsolutelynotbehappy.Thatisnotthere.That'saheadscratchthat'sreallyatscratcher.FCIcouldgetfugitives.JoeyGallohasnevermuchbutairorhomerunsright.Theguysneverbeenthatgreatofabaseballplayer.He'sbeenanallornothingtype.Theguyyeahhewalkedabunch.Pleaseneverreallyhadforhighaverage.He'sregressedtobeliterallytheworstplayerinbaseball.Idon'tknowwhytheYankeesevenputthemoutthere.He'sthesabermetricsguysareasonwhysabermetricsandbaseballaresoakedupandJuliegallowsaperfectanswer.PeoplelikeJulieGalloisahitter,eventhoughliterallystrikesat230timesayear.He'satrociousattheplatedecentintheoutfield.TheCodyBelangerleasehadahistoryofahighbattingaveragerightlynothungerstrikeouttray350timesyou'retherebutnotwhereyouthoughtyoutry200+timesayearandnowyou'relookingataguythathasnotjustregressedyouoneofbaseballfigureditoutandhe'snevermadetheadjustmenttowhatevertheyfoundoutthatthere'ssomethingtherethat'shappenswherepicturesnoticedsomethingintheworldhasbeenspreadaroundtheleague.ThisishowyougetCodyBelangerout.It'sthehighgospelcancersneverAIcan'tlayoffofitandyouknowyoucanhititsatelliteisyoumustberightischasingbadpitchestotryingtoohardtogetbooednowarepeoplestillcountingdownwasthelovereallyyeahwhyyougotintopatientandnooffensethathemightbethenicestguyevermaybekissesbabiesandtakesphotographsofeverybodythatwalksby,butatsomepoint.Gottasaveman,you'rekillingusoutthere.Icanmakeit.16.17millionbucksinyourkillingusoutthereeverytimeyouplayyourstrikeoutmachinerightnowonceeverythreetimesgoestheplaythat'sthat'sunacceptable.YouguysarereallypatientmeYankeefansgivetheJoeGallohegets.Itisalsobeen160alsothunderMattMuncywontheMunciebilgesallthewayupto11.IthinkIwrappedthingsupnexttoMaisieontheDobsonYankeeswinthatmanygameshavingAaronHicksonGallodoingverylittleinBelangerMunciedoingevenlesslineupsrightnowpitchingmyfriendswinsgamesandyouareseeingDanSchwartzmanonaFridaybillinFrenchontheguysandshowwrappingthingsup.It'saFriday.DanSchwartzmanaimforrichthericheyesandshowustheassassinationofformerPrimeMinisterJapanoutingis.IknewthishadbeentoJapanthrougharelativelygunfreecountrytocountry,like150millionpeoplepackedintolandmassthesizeofcaliph.Ijustreadthattheyhad14gundeathsinfiveyears14gundebtsandmusic.IbuiltahomemadegunfirstthingthatpoppedintomymindwhenIsawthatwhatsoeverwithClintEastwoodinthelineoffirerightwereJohnMalkovich'scharacterbuildsthehomemadegunexactlywhatIthought.Unbelievable.Crazystuff14gundeathsinfive-yearyearsisabigdebatewehaveinthiscountry,obviously,butthat'sacountrywherehavingagunisimpossiblycangetonerelatesimpossible.Unbelievablebutcrazyworldwelivein.Atthesamesimulationrelationcrazyworld,aplacelikeJapanwasoneofthemostcalm,relaxed,andsafecountriesyouevergettogotovisit.Thisisunheardofunits.Theshockwavereverberatingaroundthecountrybecausethisincredibleit'snotsomethingyouexpectmaybeastabbingyouknowwillhavethatonceinawhileguygoesonastabbingspree,butbecomesgunviolencenevermakesoneoutoflikemetaltubeswardidn'tlikeducttape,electricaltape,thingslikethatinsanityIwrapthingsup.SomeofthethingsthatkindalookattheFrenchOpenexceededtheWimbledonfinalissetsandit'sverysubduedobviouslyknowthatyourvisionlosesthefirstEddiecomesback,sweepsthelastthreeknocksoffcameranorhe'sinthefinalnosurprisethatIthinkisgoingforhisfourthstraightWimbledoncrownandwereallkindofexcitedtoseeRalphandAdeleandNovakjokeeventuallyfoundoutyesterdaythatwasknockingtohappenasthedollhadtowithdrawbecausehehasanabdominaltearonhismusclestowherehiscomplaint.Trypractice.Yes,ifI45minutescouldplaythecancerrightnowandit'sverypainful.SoNickyourusewiththewalkover,wewillseekyourYostgoingforhisfirstgrandslamandgivemuchgoodluckrightbuthereisthatyouknowchildren'sloses.ThefirstsetisnosweatrightbyguysunbelievableADElosesasetlikeyoudidtodayweplayedpoorly.Doesn'tmatter.It'slikeyouIwillneverletmejustwakeupnowandplaywheneverhealmostlostinthequarterfinals.TheJanikcenter.HewasdowntosensethenothingrightfivesteroidsatthesamerightasIgetcurrentlywakeuprightenoughofthisnonsense.636-2620movesonlosersthattheycareyes,butIdon'treallysee.Andnowhe'snotgoinglosingnowbestunning.Frankly,itabsolutelystunning.IfhewastoeverlosetoNICUradiosinafivesetmatchatstrangerthingshappenright,butnotlikelynotlookingascareerheresohe'snot.thisisnotthenicestguyintheworldbutnexttocaregiversisasaint.Iamyoulike,youknowyou'llhear,butnotasinglevaccineissuewasbigwithhimright.Thatwasamajordealbutbeforethatyoudon'tyeah,ormaybesomesportsmanshipissueshereandthere,hemaywearhisemotionsonthesleevesabit,butyouneverheardofthembeinglikeabaddudeInoonesayshe'saterribleguyontourandpeoplehatethembackfromtalkingtopeopleinvolvedintennisisprobablyaniceguyrightbutit'sfunnyhe'sbeeninthisnation.Playingprofessionallysince2007seriesplay15years.Hiscareerearningsare1561/2milliondollars.He'sobvioushecananswerthatwithmostlikelyawingsupplementlike159millionright.It'sthemoney.Theseguysmake,especiallytennisplayersoffthecourtinendorsementsthatsomassiveItheamountsofmoneytheygetanendorsementdealsbecauseinmakingit.Iguess,aremakingalotofmoney.Don'tgetmewrong,butthemostmoneyknowthatjokewhichisevermadeinaseasonintermsofprizemoneywas2015$2116.76millionartImeanmeoryouwouldlovetotomake$16.76million,butintermsofbeingaprofessionalathlete.He'smakingwhatCodyBelangerismakingandhe'samuchbettertennisplayerthanCodyBelanger'sabaseballplayerrightitcanstillturnitaroundherchildren.VictorBelangerturnedtheboatthat'smostmoniesevermadeplayingtennisinasingleseason60.76million.It'stheendorsementswemake.Likeanother4050$60billion,butisnotfedorrightisnotthedollies,notlovablelikethosetwoguyswhomakemorebeerexactlywhenitcomesendorsement.Youwantsomebodythat'smore,Iguess,personablerightthat'sonlylookthatandsaysImethimatabarandtrytohaveadrinkwiththemright.Youwantaguythatsellsyourproductthatyoufeelpeoplelikeandgravitatetojokeofagetobewithfetters.TheultimategentlemanRileyyouneverthinkofRogerFettersayingordoingthewrongthing,noractinglikeajerkonthecourtrightandgettingitintofightswithfansandallpeopleinlines,judgesandthingslikethatright.Youneverimaginethathewasn't…Youdon'tseethathappeningdrugisanotherstorylikehewillslamhisracket.Hewilldothinkthepumphimselfup.Notquite,Nick.Hereguyotsues,lunaticoutthereonthecourtbutyouwanttowatchabitlikeifitwasniceandI'mversatilejustlikeher.Youwanttosee.IwantbutifthesemifinalmatchupofNoriversusjoke.Thisisafinalhonestly,youprobablydon'twatchrightthisisCameronNorriethere'snostoryline.Thefatguybecauseit'saNovakJobit'sgoingforis1/23grandslamtotiewrapforsecond.Whateveritisandbecauseit'sthefourthinarow.He'slookingaway.ThebadboyofTennessee,wasajokeofitjustdominatedandseetheanticsofpureyearsonthecourtyouwant,thankthentrueforjoiningus.OuroneandyougrantanhourtoandgaveBlackstocksomebaseballwithhimhereinournumberthree.Alwaysabigthankyou.MartinezontheothersideoftheglassagreatjobpointonethoughtinFrench,DanSchwartzman,thisisRichIfortherealstorybehindsomeofwrestling'sbiggestmoments.It'ssomethingtowrestlewithBrucePrichardandConradThompsontoallopponents.MuchofMs.Natalieandtheconversationwearsonamotion.AndrewasnumberonebecausenotevengoingbackbeforeyouknowHolcombewasababyfaceHoltandAndreswereabletogoinheadlinetheNewOrleansSuperdomeatSheaStadiuminJapanwherevertheywent.ThatwasanattractionsomethingtowrestlewithBrucePrichardlistenwhereveryougetyourpodcasts